PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.01G183700.1.p
Common NameGLYMA_01G183700, LOC100785723
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family G2-like
Protein Properties Length: 368aa    MW: 40622.6 Da    PI: 7.4775
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.01G183700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.75.3e-33220275156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Glyma.01G183700.1.p 220 KQRRCWSPELHRRFVDALQQLGGAQVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 275
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.032217277IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-30218278IPR009057Homeodomain-like
SuperFamilySSF466892.15E-18218278IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-27220275IPR006447Myb domain, plants
PfamPF002496.4E-8222273IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MVVCDFWELS LAQSQRKTPK SNIIMEPSLD LRLGFVPKPL SLFFGDVSGN RDKCDKVVTL  60
DGFVQRLEEE LTKVEAFKRE LPLCILLLND AIARLKEEKV KCSGMQDPPL KTSSGGNENE  120
NSEKKNWMSS AQLWSTQKSK SRNEEDDRSV PANSINGNSC VPEKEGSQVP SFGLMARASE  180
LSHSNSKSVG GDTSSGSSLL RVEVQSQPQP PQHMQQNPRK QRRCWSPELH RRFVDALQQL  240
GGAQVATPKQ IRELMQVEGL TNDEVKSHLQ KYRLHVRRFP VFSIGQVDNG SWMTQDECGD  300
KSKGNMSQSG SPQGPLTPLL LGGAGSAKGL SSPGRNSVDA EDEQSSDCRN WKGGLHHQQL  360
ETDNHSL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.272940.0stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150436e-88AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517284.20.0PREDICTED: uncharacterized protein LOC100785723
TrEMBLI1J9450.0I1J945_SOYBN; Uncharacterized protein
STRINGGLYMA01G39040.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Representative plantOGRP25631133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.18e-55G2-like family protein